Bacillus anthracis Ames: BA_2373 Help Entry BA_2373           CDS       T00129                                  Name (GenBank) mbtH-like protein   KO K05375   MbtH protein Organism ban  Bacillus anthracis Ames Pathway ban00261   Monobactam biosynthesis ban01100   Metabolic pathways ban01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ban00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BA_2373  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ban01008]     BA_2373 Polyketide biosynthesis proteins [BR:ban01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BA_2373 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AAP26241 UniProt:  A0A4Y1W1U7 LinkDB All DBs Position 2213664..2213888 Genome browser AA seq 74 aa AA seqDB search MTNPFENDNYTYKVLKNEEGQYSLWPAFLDVPIGWNVVHKEASRNDCLQYVENNWEDLNP KSNQVGKKILVGKR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacgaatccatttgaaaatgataattacacatataaagtattaaaaaatgaggagggc cagtattctctctggcctgcctttcttgatgtacctattggttggaacgtcgtacataaa gaggctagtaggaatgattgtttacaatatgttgaaaataactgggaagatttgaatcca aaaagtaatcaagttggcaaaaaaatattagtaggaaaacgataa

DBGET integrated database retrieval system