Bacillus anthracis HYU01: HYU01_00410 Help Entry HYU01_00410       CDS       T03394                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism banh  Bacillus anthracis HYU01 Pathway banh00790   Folate biosynthesis banh01100   Metabolic pathways banh01240   Biosynthesis of cofactors Module banh_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:banh00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     HYU01_00410 Enzymes [BR:banh01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      HYU01_00410  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      HYU01_00410  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      HYU01_00410 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Costars Spore_GerAC Motif Other DBs NCBI-ProteinID:  AIF54574 UniProt:  A0A6H3A5H0 LinkDB All DBs Position 78340..78702 Genome browser AA seq 120 aa AA seqDB search MDKIYIHDMEFYGYHGVFPEENKLGQRFKVDLTVELDLKRAGESDDLEHSVNYGELFELC RKVVEDRTYKLVESIAENIATDILKQYESISRCTIKVIKPDPPIPGHYRAVAVEITRERP NT seq 363 nt NT seq  +upstreamnt  +downstreamnt ttggataaaatttatattcatgatatggagttttacggttatcatggtgtattcccagag gaaaataaattgggccagagatttaaagtggacttaacggtggaattggatttgaaacga gcgggagaaagtgatgacttagagcattctgttaattatggagagcttttcgagttatgt agaaaagttgttgaagatagaacatataagcttgtagagagtattgctgaaaatatcgct acagatatattgaaacaatatgagagtatttcaagatgtacgataaaggtaattaaaccg gatccgccgataccgggacattatcgtgctgtagcggtagaaattacgagagaacgtcca tga

DBGET integrated database retrieval system