Bacillus anthracis HYU01: HYU01_11810 Help Entry HYU01_11810       CDS       T03394                                  Name (GenBank) antibiotic transporter   KO K05375   MbtH protein Organism banh  Bacillus anthracis HYU01 Pathway banh00261   Monobactam biosynthesis banh01100   Metabolic pathways banh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:banh00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     HYU01_11810  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:banh01008]     HYU01_11810 Polyketide biosynthesis proteins [BR:banh01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     HYU01_11810 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AIF56587 UniProt:  A0A4Y1W1U7 LinkDB All DBs Position 2200437..2200661 Genome browser AA seq 74 aa AA seqDB search MTNPFENDNYTYKVLKNEEGQYSLWPAFLDVPIGWNVVHKEASRNDCLQYVENNWEDLNP KSNQVGKKILVGKR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacgaatccatttgaaaatgataattacacatataaagtattaaaaaatgaggagggc cagtattctctctggcctgcctttcttgatgtacctattggttggaacgtcgtacataaa gaggctagtaggaatgattgtttacaatatgttgaaaataactgggaagatttgaatcca aaaagtaatcaagttggcaaaaaaatattagtaggaaaacgataa

DBGET integrated database retrieval system