Bacillus anthracis A16R: A16R_24330 Help Entry A16R_24330        CDS       T02999                                  Name (GenBank) antibiotic transporter   KO K05375   MbtH protein Organism banr  Bacillus anthracis A16R Pathway banr00261   Monobactam biosynthesis banr01100   Metabolic pathways banr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:banr00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     A16R_24330  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:banr01008]     A16R_24330 Polyketide biosynthesis proteins [BR:banr01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     A16R_24330 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AHE83774 LinkDB All DBs Position 2213906..2214130 Genome browser AA seq 74 aa AA seqDB search MTNPFENDNYTYKVLKNEEGQYSLWPAFLDVPIGWNVVHKEASRNDCLQYVENNWEDLNP KSNQVGKKILVGKR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacgaatccatttgaaaatgataattacacatataaagtattaaaaaatgaggagggc cagtattctctctggcctgcctttcttgatgtacctattggttggaacgtcgtacataaa gaggctagtaggaatgattgtttacaatatgttgaaaataactgggaagatttgaatcca aaaagtaatcaagttggcaaaaaaatattagtaggaaaacgataa

DBGET integrated database retrieval system