Bacillus anthracis A16: A16_24060 Help Entry A16_24060         CDS       T02998                                  Name (GenBank) antibiotic transporter   KO K05375   MbtH protein Organism bant  Bacillus anthracis A16 Pathway bant00261   Monobactam biosynthesis bant01100   Metabolic pathways bant01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bant00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     A16_24060  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bant01008]     A16_24060 Polyketide biosynthesis proteins [BR:bant01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     A16_24060 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AHE89667 LinkDB All DBs Position 2213931..2214155 Genome browser AA seq 74 aa AA seqDB search MTNPFENDNYTYKVLKNEEGQYSLWPAFLDVPIGWNVVHKEASRNDCLQYVENNWEDLNP KSNQVGKKILVGKR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacgaatccatttgaaaatgataattacacatataaagtattaaaaaatgaggagggc cagtattctctctggcctgcctttcttgatgtacctattggttggaacgtcgtacataaa gaggctagtaggaatgattgtttacaatatgttgaaaataactgggaagatttgaatcca aaaagtaatcaagttggcaaaaaaatattagtaggaaaacgataa

DBGET integrated database retrieval system