Bacillus anthracis Sterne: BAS2209 Help Entry BAS2209           CDS       T00184                                  Name (GenBank) mbtH-like protein   KO K05375   MbtH protein Organism bat  Bacillus anthracis Sterne Pathway bat00261   Monobactam biosynthesis bat01100   Metabolic pathways bat01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bat00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BAS2209  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bat01008]     BAS2209 Polyketide biosynthesis proteins [BR:bat01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BAS2209 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AAT54521 LinkDB All DBs Position 2213770..2213994 Genome browser AA seq 74 aa AA seqDB search MTNPFENDNYTYKVLKNEEGQYSLWPAFLDVPIGWNVVHKEASRNDCLQYVENNWEDLNP KSNQVGKKILVGKR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacgaatccatttgaaaatgataattacacatataaagtattaaaaaatgaggagggc cagtattctctctggcctgcctttcttgatgtacctattggttggaacgtcgtacataaa gaggctagtaggaatgattgtttacaatatgttgaaaataactgggaagatttgaatcca aaaagtaatcaagttggcaaaaaaatattagtaggaaaacgataa

DBGET integrated database retrieval system