Bacillus anthracis H9401: H9401_2252 Help Entry H9401_2252        CDS       T02028                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism bax  Bacillus anthracis H9401 Pathway bax00261   Monobactam biosynthesis bax01100   Metabolic pathways bax01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bax00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     H9401_2252  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bax01008]     H9401_2252 Polyketide biosynthesis proteins [BR:bax01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     H9401_2252 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AFH83638 LinkDB All DBs Position 2204062..2204286 Genome browser AA seq 74 aa AA seqDB search MTNPFENDNYTYKVLKNEEGQYSLWPAFLDVPIGWNVVHKEASRNDCLQYVENNWEDLNP KSNQVGKKILVGKR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacgaatccatttgaaaatgataattacacatataaagtattaaaaaatgaggagggc cagtattctctctggcctgcctttcttgatgtacctattggttggaacgtcgtacataaa gaggctagtaggaatgattgtttacaatatgttgaaaataactgggaagatttgaatcca aaaagtaatcaagttggcaaaaaaatattagtaggaaaacgataa

DBGET integrated database retrieval system