Bacillus velezensis FZB42: RBAM_000890 Help Entry RBAM_000890       CDS       T00582                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism bay  Bacillus velezensis FZB42 Pathway bay00790   Folate biosynthesis bay01100   Metabolic pathways bay01240   Biosynthesis of cofactors Module bay_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:bay00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     RBAM_000890 (folB) Enzymes [BR:bay01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      RBAM_000890 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      RBAM_000890 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      RBAM_000890 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ABS72527 UniProt:  A7Z0K1 LinkDB All DBs Position 87218..87580 Genome browser AA seq 120 aa AA seqDB search MDKVYVEGMEFYGYHGVFEEENKLGQRFKVDLTAELDLSKAGKTDDLSYTINYAELYSVC RGIVEGEPVNLVETLAERIADTVLEKFEPVQQCTVKVVKPDPPIPGHYKSVAIEMTRKKS NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggataaagtatatgtagaaggtatggagttttacggatatcacggtgtgttcgaagaa gaaaacaaactcggccagcgcttcaaagtagacctgactgccgaactggatttgagcaaa gcgggaaaaacggatgacctttcttataccattaactatgcggaattgtacagtgtctgc cgcggcatcgttgagggcgaacccgtcaatttggtcgagacgcttgcggaacggatcgca gacaccgtccttgagaaatttgagccggtgcagcaatgtacggtaaaggttgttaagcct gacccgccgattcccggccattataaatcagtggccatagaaatgacgagaaagaaatca tga

DBGET integrated database retrieval system