Bradyrhizobium betae: F8237_03260 Help Entry F8237_03260       CDS       T06368                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism bbet  Bradyrhizobium betae Pathway bbet00261   Monobactam biosynthesis bbet01100   Metabolic pathways bbet01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bbet00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     F8237_03260  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bbet01008]     F8237_03260 Polyketide biosynthesis proteins [BR:bbet01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     F8237_03260 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QFI71472 UniProt:  A0A5P6NZK3 LinkDB All DBs Position complement(624859..625086) Genome browser AA seq 75 aa AA seqDB search MDGEPASGNWSIDGDEFVVLVNHDAQYAIWPAAKPIPAGWNQAHSAAQKADCLAFVESCW IDMRAGKLPDRTVQR NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggatggggagccagcgtctggcaattggtcaatcgacggcgatgaattcgtcgtcctt gtcaatcatgacgcgcaatatgcgatctggccggctgccaagccgattccagctggctgg aatcaggcacattcggcggcgcaaaaggccgactgtctggccttcgtcgaaagctgctgg atcgacatgcgtgccggcaaactcccggaccggaccgtccagcgttga

DBGET integrated database retrieval system