Bison bison bison (American bison): 104998700 Help Entry 104998700         CDS       T08726                                  Symbol FTH1 Name (RefSeq) ferritin heavy chain   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism bbis  Bison bison bison (American bison) Pathway bbis00860   Porphyrin metabolism bbis04216   Ferroptosis bbis04217   Necroptosis bbis04978   Mineral absorption Brite KEGG Orthology (KO) [BR:bbis00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     104998700 (FTH1)  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     104998700 (FTH1)    04217 Necroptosis     104998700 (FTH1)  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     104998700 (FTH1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbis04147]     104998700 (FTH1) Enzymes [BR:bbis01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      104998700 (FTH1) Exosome [BR:bbis04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    104998700 (FTH1)   Exosomal proteins of bladder cancer cells    104998700 (FTH1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ferritin Rubrerythrin Motif Other DBs NCBI-GeneID:  104998700 NCBI-ProteinID:  XP_010852330 UniProt:  A0A6P3IMQ3 LinkDB All DBs Position Unknown AA seq 150 aa AA seqDB search MFMFYFQSYYFDRDDVALKNFAKYFLHQSHEEREHAERLMKLQNQRGGRIFLQDIKKPDR DDWENGLTAMECALCLERSVNQSLLELHKLATEKNDPHLCDFIETHYLNEQVEAIKELGD HITNLRKMGAPGSGMAEYLFDKHTLGHSES NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atgttcatgttctactttcagtcgtactattttgaccgtgatgatgtggctttgaagaac tttgccaaatactttcttcaccaatctcatgaggagagggaacatgctgagagactgatg aagctgcagaaccagcgaggcggccgaatcttccttcaggatatcaagaaaccagaccgt gatgactgggagaatggactgactgcaatggaatgtgcgctgtgcttggagagaagtgtg aatcagtcactactggaactgcacaaactggccactgaaaaaaatgatccccatctgtgt gatttcattgagactcattacctgaatgagcaggtggaagccatcaaagaattgggtgac cacataaccaacctgcgcaagatgggggcccctggatctggcatggcagagtacctcttt gacaagcacaccctgggacacagtgagagctaa

DBGET integrated database retrieval system