Bacillus cabrialesii: EFK13_16385 Help Entry EFK13_16385       CDS       T08101                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism bcab  Bacillus cabrialesii Pathway bcab00261   Monobactam biosynthesis bcab01100   Metabolic pathways bcab01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bcab00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     EFK13_16385  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bcab01008]     EFK13_16385 Polyketide biosynthesis proteins [BR:bcab01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     EFK13_16385 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  UQE78278 LinkDB All DBs Position complement(3192467..3192676) Genome browser AA seq 69 aa AA seqDB search MANPFENADGTYLVLVNEEGQYSLWPGFIDVPSGWTVVHEQKGREACLDYIQSHWSDMRP NSLKPVENV NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggcaaatccttttgaaaatgcggatggcacatatttggtgctggtcaatgaagagggc cagtattccctatggcccggatttatagatgtaccgagcggctggacagtcgttcatgag caaaaagggcgtgaagcttgtctggactatatccaatcgcattggagcgatatgaggcca aacagcctaaagcctgttgaaaatgtatga

DBGET integrated database retrieval system