Paraburkholderia caribensis: K788_0001106 Help Entry K788_0001106      CDS       T04141                                  Name (GenBank) putative MbtH-like protein   KO K05375   MbtH protein Organism bcai  Paraburkholderia caribensis Pathway bcai00261   Monobactam biosynthesis bcai01100   Metabolic pathways bcai01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bcai00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     K788_0001106  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bcai01008]     K788_0001106 Polyketide biosynthesis proteins [BR:bcai01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     K788_0001106 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ALL67772 UniProt:  A0A0P0RGU8 LinkDB All DBs Position 2:complement(1651898..1652131) Genome browser AA seq 77 aa AA seqDB search MTQNTHQDAQHDVQYTVVINDEEQYSIWPTFRDVPAGWREVGVRGPKAACLEHIESVWTD MRPASLRRHMDAAPNTR NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgacccagaacacgcatcaagacgcacagcacgacgttcaatacacggtcgtcatcaac gacgaagaacagtattcgatctggccgacgttccgcgacgtgcctgcgggctggcgcgaa gtcggcgtgcgcgggccgaaggccgcgtgcctcgagcatatcgaaagcgtatggaccgac atgcgtcccgcgagcctgcgcaggcacatggacgccgcgccgaacacgcgttga

DBGET integrated database retrieval system