Burkholderia cepacia DDS 7H-2: DM42_61 Help Entry DM42_61           CDS       T03302                                  Name (GenBank) mbtH-like family protein   KO K05375   MbtH protein Organism bced  Burkholderia cepacia DDS 7H-2 Pathway bced00261   Monobactam biosynthesis bced01100   Metabolic pathways bced01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bced00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     DM42_61  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bced01008]     DM42_61 Polyketide biosynthesis proteins [BR:bced01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     DM42_61 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AIO48383 LinkDB All DBs Position 1:complement(82017..82259) Genome browser AA seq 80 aa AA seqDB search MTQAPTPSADTDDLVYTVVINDEEQYSIWPTFRPVPAGWREVGVSGPKADCLAHIETVWT DMRPASLRRAMDGERATRAS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacgcaagccccgacgccttccgccgacaccgacgatctcgtctatacggtcgtcatc aacgacgaagaacagtattcgatctggccgacgttccggccggtgccggccggctggcgc gaagtcggcgtgagcggcccgaaggccgactgtctcgcgcacatcgagacggtctggacc gacatgcgccccgcgagcctgcgccgcgcgatggacggcgagcgcgcgacgcgcgcgtca tga

DBGET integrated database retrieval system