Bacillus cereus FT9: BcrFT9_01881 Help Entry BcrFT9_01881      CDS       T03417                                  Name (GenBank) mbtH protein-like protein   KO K05375   MbtH protein Organism bcef  Bacillus cereus FT9 Pathway bcef00261   Monobactam biosynthesis bcef01100   Metabolic pathways bcef01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bcef00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BcrFT9_01881  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bcef01008]     BcrFT9_01881 Polyketide biosynthesis proteins [BR:bcef01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BcrFT9_01881 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AIE79423 LinkDB All DBs Position 2296719..2296943 Genome browser AA seq 74 aa AA seqDB search MTNPFENDNYTYKVLINEEGQYSLWPVFLDVPIGWNVVHEEASRHDCLQYVENNWTDLNP KSNQAGEKIVVGKR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacgaatccatttgaaaacgataattacacatataaagtattaataaatgaggagggc cagtattctctctggcctgtctttcttgatgtacctattgggtggaatgtcgtacatgaa gaagctagcaggcacgattgcttacaatatgttgaaaataactggacagatttgaatcca aaaagtaatcaagctggtgaaaaaatagtagtaggaaaacgataa

DBGET integrated database retrieval system