Burkholderia cenocepacia DDS 22E-1: DM39_1599 Help Entry DM39_1599         CDS       T03308                                  Name (GenBank) mbtH-like family protein   KO K05375   MbtH protein Organism bcen  Burkholderia cenocepacia DDS 22E-1 Pathway bcen00261   Monobactam biosynthesis bcen01100   Metabolic pathways bcen01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bcen00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     DM39_1599  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bcen01008]     DM39_1599 Polyketide biosynthesis proteins [BR:bcen01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     DM39_1599 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AIO32611 UniProt:  A0A088U5Y1 LinkDB All DBs Position 1:1726106..1726348 Genome browser AA seq 80 aa AA seqDB search MTQATTPSADTDDLVYTVVINDEEQYSIWPTFRPVPAGWREVGVRGPKADCLAHIETAWT DMRPASLRRAMDGERASSAS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacgcaagccacgacgccttccgccgacaccgacgatctcgtctacacggtcgtcatc aacgacgaagaacagtattcgatctggccgaccttccggcccgtaccggccggctggcgc gaggtcggcgtgcgcgggccgaaggccgactgtctcgcgcacatcgaaaccgcgtggacc gacatgcgccccgcgagcctgcgccgcgcgatggacggcgagcgcgcgtcgagcgcatcg tga

DBGET integrated database retrieval system