Burkholderia cenocepacia H111: I35_3054 Help Entry I35_3054          CDS       T03804                                  Name (GenBank) Dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism bceo  Burkholderia cenocepacia H111 Pathway bceo00790   Folate biosynthesis bceo01100   Metabolic pathways bceo01240   Biosynthesis of cofactors Module bceo_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:bceo00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     I35_3054 Enzymes [BR:bceo01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      I35_3054  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      I35_3054  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      I35_3054 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  CDN61577 LinkDB All DBs Position 1:3297805..3298143 Genome browser AA seq 112 aa AA seqDB search MHINIGAFEHEKRGEQRVVINVDLFVPLALSTPVDDRLHEVVDYDLMKQSVAQCVARGHI HLQETLCDSIAAHLLAHDAVRAVRVRTEKPDAYPDCDAVGVEVFRIKDEERA NT seq 339 nt NT seq  +upstreamnt  +downstreamnt gtgcacatcaacatcggggccttcgaacacgagaagcgcggcgagcagcgcgtcgtcatc aacgtcgacctgttcgtgccgctcgcgctgtccaccccggtcgacgaccggctgcacgaa gtcgtcgactacgatctgatgaagcagagcgtcgcgcaatgcgtggcgcgcggccacatc cacctgcaggagacgctgtgcgattcgatcgccgcgcacctgctggcgcacgatgccgtg cgcgcggtacgcgtccgtaccgagaaaccggacgcctatccggactgcgacgccgtcggc gtcgaagtctttcgcatcaaggacgaggagcgcgcatga

DBGET integrated database retrieval system