Burkholderia cenocepacia DWS 37E-2: DM40_2266 Help Entry DM40_2266         CDS       T03488                                  Name (GenBank) mbtH-like family protein   KO K05375   MbtH protein Organism bcew  Burkholderia cenocepacia DWS 37E-2 Pathway bcew00261   Monobactam biosynthesis bcew01100   Metabolic pathways bcew01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bcew00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     DM40_2266  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bcew01008]     DM40_2266 Polyketide biosynthesis proteins [BR:bcew01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     DM40_2266 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AIO41777 UniProt:  A0AA86KL26 LinkDB All DBs Position 1:2442414..2442653 Genome browser AA seq 79 aa AA seqDB search MTQATTPSDTDDIVYTVVINDEEQYSIWPTFRPVPAGWREVGVSGPKADCLAHIETVWTD MRPASLRRAMDGERASRAS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgacgcaagccacgacgccttccgataccgacgacatcgtctacacggtcgtcatcaac gacgaagaacagtattcgatctggccgacgttccggcccgtgccggccggctggcgcgaa gttggcgtgagcggcccgaaggccgattgcctcgcgcacatcgaaacggtttggaccgac atgcgcccggcgagcctgcgccgcgcgatggacggcgagcgcgcttcacgcgcgtcgtga

DBGET integrated database retrieval system