Bacillus cereus F837/76: bcf_11805 Help Entry bcf_11805         CDS       T01703                                  Name (GenBank) Polymyxin synthetase PmxB   KO K05375   MbtH protein Organism bcf  Bacillus cereus F837/76 Pathway bcf00261   Monobactam biosynthesis bcf01100   Metabolic pathways bcf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bcf00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     bcf_11805  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bcf01008]     bcf_11805 Polyketide biosynthesis proteins [BR:bcf01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     bcf_11805 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AEW55483 LinkDB All DBs Position 2237393..2237617 Genome browser AA seq 74 aa AA seqDB search MTNPFENDNYTYKVLKNEEGQYSLWPAFLDVPIGWNVVHKEASRNDCLQYVENNWEDLNP KSNQVGKKILVGKR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacgaatccatttgaaaatgataattacacatataaagtattaaaaaatgaggagggc cagtattctctctggcctgcctttcttgatgtacctattggttggaacgtcgtacataaa gaggctagtaggaatgattgtttacaatatgttgaaaataactgggaagatttgaatcca aaaagtaatcaagttggcaaaaaaatattagtaggaaaacgataa

DBGET integrated database retrieval system