Bacillus cereus G9842: BCG9842_B5236 Help Entry BCG9842_B5236     CDS       T00815                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism bcg  Bacillus cereus G9842 Pathway bcg00790   Folate biosynthesis bcg01100   Metabolic pathways bcg01240   Biosynthesis of cofactors Module bcg_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:bcg00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     BCG9842_B5236 (folB) Enzymes [BR:bcg01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      BCG9842_B5236 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      BCG9842_B5236 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      BCG9842_B5236 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Costars Motif Other DBs NCBI-ProteinID:  ACK94478 UniProt:  B7ISY3 LinkDB All DBs Position 78090..78452 Genome browser AA seq 120 aa AA seqDB search MDKIYIHDMEFYGYHGVFPEENKLGQRFKVDLTVELDLKRAGESDELEHSVNYGELFELC RKVVEDRKYKLVESIAENIAADILKQYESISRCTIKVIKPDPPIPGHYRAVAVEITRERP NT seq 363 nt NT seq  +upstreamnt  +downstreamnt ttggataaaatttatatccatgatatggagttttacggttatcatggtgtgttcccggag gaaaataaattaggtcagagatttaaagttgacttaacggtggagttggatttaaagcgt gcaggggaaagtgatgaattagagcattcggtcaattatggagagcttttcgaattatgt agaaaagttgttgaagatagaaagtataagcttgtggagagtatcgctgaaaatattgct gcagatatattaaaacaatatgaaagtatttcacgatgtacaattaaggtaattaagccg gatccaccgataccaggtcattatcgtgctgtagcagtagaaattacgagagaacgtcca tga

DBGET integrated database retrieval system