Burkholderia cenocepacia J2315: BCAL1689 Help Entry BCAL1689          CDS       T00771                                  Symbol orbH Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism bcj  Burkholderia cenocepacia J2315 Pathway bcj00261   Monobactam biosynthesis bcj01100   Metabolic pathways bcj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bcj00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BCAL1689 (orbH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bcj01008]     BCAL1689 (orbH) Polyketide biosynthesis proteins [BR:bcj01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BCAL1689 (orbH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  CAR51987 UniProt:  B4E987 LinkDB All DBs Position 1:1847208..1847450 Genome browser AA seq 80 aa AA seqDB search MTQAPTPSADTDDLVYTVVINDEEQYSIWPTFRPVPAGWREVGVSGPKADCLAHIETVWT DMRPASLRRAMDGERATRAS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacgcaagccccgacgccttccgccgacaccgacgatctcgtctatacggtcgtcatc aacgacgaagaacagtattcgatctggccgacgttccggccggtgccggccggctggcgc gaagtcggcgtgagcggcccgaaggccgactgtctcgcgcacatcgagacggtctggacc gacatgcgccccgcgagcctgcgccgcgcgatggacggcgagcgcgcgacgcgcgcgtcg tga

DBGET integrated database retrieval system