Burkholderia orbicola: Bcenmc03_1608 Help Entry Bcenmc03_1608     CDS       T00669                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism bcm  Burkholderia orbicola Pathway bcm00261   Monobactam biosynthesis bcm01100   Metabolic pathways bcm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bcm00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Bcenmc03_1608  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bcm01008]     Bcenmc03_1608 Polyketide biosynthesis proteins [BR:bcm01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Bcenmc03_1608 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ACA90781 UniProt:  B1K127 LinkDB All DBs Position 1:1778448..1778690 Genome browser AA seq 80 aa AA seqDB search MTQAPTPSADTDDLVYTVVINDEEQYSIWPTFRPVPAGWREVGVSGPKADCLAHIETVWT DMRPASLRRAMDGERATRAS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacgcaagccccgacgccttccgccgacaccgacgatctcgtctatacggtcgtcatc aacgacgaagaacagtattcgatctggccgacgttccggcccgtgccggccggctggcgc gaggtcggcgtgagcggcccgaaggccgactgtctcgcgcacatcgagaccgtctggacc gacatgcgccccgcgagcctgcgccgcgcgatggacggcgagcgcgcgacgcgcgcgtcg tga

DBGET integrated database retrieval system