Burkholderia contaminans: NL30_14255 Help Entry NL30_14255        CDS       T03969                                  Name (GenBank) membrane protein   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism bcon  Burkholderia contaminans Pathway bcon00190   Oxidative phosphorylation bcon01100   Metabolic pathways bcon02020   Two-component system Module bcon_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:bcon00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     NL30_14255  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     NL30_14255 Enzymes [BR:bcon01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      NL30_14255 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB B277 Motif Other DBs NCBI-ProteinID:  AKM40968 UniProt:  A0A3N8R8K9 LinkDB All DBs Position 1:complement(3208434..3208580) Genome browser AA seq 48 aa AA seqDB search MWYFSWILGIGVALGFGIINAMWLEAEVFSRGDKRNGASSTRSGGNAS NT seq 147 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttctcgtggatactcggcatcggcgtggcgctcggcttcggcatcatcaac gcgatgtggctggaagcggaagtcttctcgcgcggcgacaagcgcaacggcgcgtcgagc acgcgctcgggaggcaacgcttcgtga

DBGET integrated database retrieval system