Bacillus cereus Q1: BCQ_2299 Help Entry BCQ_2299          CDS       T00852                                  Symbol mbtH Name (GenBank) MbtH protein   KO K05375   MbtH protein Organism bcq  Bacillus cereus Q1 Pathway bcq00261   Monobactam biosynthesis bcq01100   Metabolic pathways bcq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bcq00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BCQ_2299 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bcq01008]     BCQ_2299 (mbtH) Polyketide biosynthesis proteins [BR:bcq01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BCQ_2299 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ACM12727 UniProt:  B9J015 LinkDB All DBs Position 2268460..2268684 Genome browser AA seq 74 aa AA seqDB search MTNPFENDNYTYKVLINEEGQYSLWPVFLDVPIGWNVVHEEASRHDCLQYVENTWTDLNP KSNQAGEKIVVGKR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacgaatccatttgaaaatgataattacacatataaagtattaataaatgaagagggc cagtattctctctggcctgtctttcttgatgtacctattgggtggaatgtcgtacatgaa gaagctagcaggcacgattgcttacaatatgttgaaaatacctggacggatttgaatcca aaaagtaatcaagctggtgaaaaaatagtagtaggaaaacgataa

DBGET integrated database retrieval system