Bacillus cereus AH820: BCAH820_2391 Help Entry BCAH820_2391      CDS       T00814                                  Name (GenBank) mbtH-like protein   KO K05375   MbtH protein Organism bcu  Bacillus cereus AH820 Pathway bcu00261   Monobactam biosynthesis bcu01100   Metabolic pathways bcu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bcu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BCAH820_2391  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bcu01008]     BCAH820_2391 Polyketide biosynthesis proteins [BR:bcu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BCAH820_2391 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ACK90518 UniProt:  B7JNJ3 LinkDB All DBs Position 2277615..2277839 Genome browser AA seq 74 aa AA seqDB search MTNPFENDNYTYKVLKNEEGQYSLWPAFLDVPIGWNVVHKEASRNDCLQYVENNWEDLNP KSNQVGKKILVGKR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacgaatccgtttgaaaatgataattacacatataaagtattaaaaaatgaggagggc cagtattctctctggcctgcctttcttgatgtacctattggttggaacgtcgtacataaa gaggctagtaggaatgattgtttacaatatgttgaaaataactgggaagatttgaatcca aaaagtaatcaagttggcaaaaaaatattagtaggaaaacgataa

DBGET integrated database retrieval system