Bacillus cereus 03BB102: BCA_2440 Help Entry BCA_2440          CDS       T00869                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism bcx  Bacillus cereus 03BB102 Pathway bcx00261   Monobactam biosynthesis bcx01100   Metabolic pathways bcx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bcx00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BCA_2440  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bcx01008]     BCA_2440 Polyketide biosynthesis proteins [BR:bcx01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BCA_2440 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ACO26472 UniProt:  A0A158RHJ0 LinkDB All DBs Position 2276577..2276801 Genome browser AA seq 74 aa AA seqDB search MTNPFENDNYTYKVLKNEEGQYSLWPAFLDVPIGWNVVHKEVSRNDCLQYVENNWEDLNP KSNQVGKKILVGKR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacgaatccatttgaaaatgataattacacatataaagtattaaaaaatgaggagggc cagtattctctctggcctgcctttcttgatgtacctattggttggaacgtcgtacataaa gaggttagtaggaatgattgtttacaatatgttgaaaataactgggaagatttgaatcca aaaagtaatcaagttggcaaaaaaatattagtaggaaaacgataa

DBGET integrated database retrieval system