Bacillus cytotoxicus: Bcer98_1759 Help Entry Bcer98_1759       CDS       T00560                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism bcy  Bacillus cytotoxicus Pathway bcy00261   Monobactam biosynthesis bcy01100   Metabolic pathways bcy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bcy00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Bcer98_1759  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bcy01008]     Bcer98_1759 Polyketide biosynthesis proteins [BR:bcy01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Bcer98_1759 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ABS22059 UniProt:  A7GPK1 LinkDB All DBs Position 1875882..1876103 Genome browser AA seq 73 aa AA seqDB search MTNPFENDNDMYKVLINEEGQHSVWPAFLDVPAGWSVVHDNDSRQACLTYIELHWTDMMP KRLHQLEYVSVGK NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgacgaatccatttgaaaatgataatgatatgtataaagtgttaataaatgaagaaggc cagcattctgtctggccggcttttcttgatgtaccagctggttggagcgttgtgcatgac aatgatagtaggcaagcttgtctaacatatattgaattacactggacggatatgatgcca aagcgtcttcatcaacttgaatatgtatcagtagggaagtaa

DBGET integrated database retrieval system