Bradyrhizobium daqingense: LPJ38_19375 Help Entry LPJ38_19375       CDS       T07756                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism bdg  Bradyrhizobium daqingense Pathway bdg00261   Monobactam biosynthesis bdg01100   Metabolic pathways bdg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bdg00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     LPJ38_19375  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bdg01008]     LPJ38_19375 Polyketide biosynthesis proteins [BR:bdg01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     LPJ38_19375 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  UFS85858 LinkDB All DBs Position 4101144..4101371 Genome browser AA seq 75 aa AA seqDB search MMVFDRDDVTFTVVVNHEEQYSIWPTFKEIPAGWMAVGKTGSKKECLDHIEQVWTDMRPL SLRKFMDGASPRQST NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgatggtgttcgacagggacgacgtcaccttcaccgtcgtcgtcaatcacgaagagcaa tattccatctggccgacgttcaaggagatcccggccggctggatggcagtggggaagacc ggcagcaagaaggaatgtctcgaccacatcgaacaggtgtggaccgacatgcgtccgctc agcttgcgcaaattcatggacggcgcgtcgcctcggcagtcgacgtag

DBGET integrated database retrieval system