Phocaeicola dorei HS1_L_3_B_079: GV66_00025 Help Entry GV66_00025        CDS       T03263                                  Name (GenBank) dienelactone hydrolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism bdh  Phocaeicola dorei HS1_L_3_B_079 Pathway bdh00790   Folate biosynthesis bdh01100   Metabolic pathways bdh01240   Biosynthesis of cofactors Module bdh_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:bdh00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     GV66_00025 Enzymes [BR:bdh01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      GV66_00025  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      GV66_00025  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      GV66_00025 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AII66195 UniProt:  A0A076IWK0 LinkDB All DBs Position 8366..8734 Genome browser AA seq 122 aa AA seqDB search MKATSMYIYLEGAKFFAHHGVDPQETIVGANFIIDLKLRTDFTHAAQTDELKGTVSYADI YAVVKKEMKASSKLLEHVCERIGQRLFSEFPTIQEIIIRLSKENPPMGSDCRNVGVEVHY TR NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgaaagcaacatctatgtatatttatttggaaggtgccaagtttttcgctcaccacgga gtcgatccacaagaaacaatagtaggagctaattttataattgatttaaaactaagaact gatttcacccatgcagcacaaacagacgaactgaaaggtaccgtaagttatgctgatata tatgcagttgtcaaaaaagaaatgaaagcttcatccaaacttttagaacatgtctgtgaa cgcatagggcaaagactatttagtgaatttccaactattcaggaaataatcatccggtta tcaaaagaaaatccgcctatgggaagtgattgcagaaatgttggagtagaagtacattat acacgatga

DBGET integrated database retrieval system