Phocaeicola dorei HS1_L_3_B_079: GV66_12045 Help Entry GV66_12045        CDS       T03263                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism bdh  Phocaeicola dorei HS1_L_3_B_079 Pathway bdh00020   Citrate cycle (TCA cycle) bdh01100   Metabolic pathways bdh01110   Biosynthesis of secondary metabolites bdh01120   Microbial metabolism in diverse environments bdh01200   Carbon metabolism bdh01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:bdh00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     GV66_12045 Enzymes [BR:bdh01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      GV66_12045 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_2 Fer4_6 Fer4_21 Fer4_7 Fer4_10 Fer4_9 Fer4_4 Fer4_16 Fer4_15 Fer4_8 Fer4_22 Fer4_20 Fer4_17 DUF5651 Fer4_13 Fer4_3 Motif Other DBs NCBI-ProteinID:  AII68390 UniProt:  A0A076J1Q2 LinkDB All DBs Position complement(3050284..3050514) Genome browser AA seq 76 aa AA seqDB search MAKIKGAIVVDTERCKGCNLCVVACPLHVIALNAKQVNKKGYTFAHQVLEDTCNGCASCA TVCPDGCITVYKVKQQ NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcaaagattaaaggtgctattgtagtagacacagagcgttgcaaaggttgcaatcta tgtgtagtggcatgtccgctacatgtaatcgcgctcaatgccaaacaagtgaataaaaaa ggatacacattcgcccaccaggtattagaggatacctgcaatggttgcgcatcatgtgcc acagtctgtccggacggatgcattactgtgtataaagtaaaacaacaataa

DBGET integrated database retrieval system