Burkholderia dolosa: AK34_1467 Help Entry AK34_1467         CDS       T03793                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism bdl  Burkholderia dolosa Pathway bdl00261   Monobactam biosynthesis bdl01100   Metabolic pathways bdl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bdl00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     AK34_1467  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bdl01008]     AK34_1467 Polyketide biosynthesis proteins [BR:bdl01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     AK34_1467 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AJY13665 LinkDB All DBs Position 1:complement(1594874..1595116) Genome browser AA seq 80 aa AA seqDB search MTQATTPSADTDDLVYTVVINDEEQYSIWPTFRPVPAGWREVGVRGPKADCLAHIEAVWT DMRPASLRRAMDGERASSAS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacgcaagccacgacgccttccgccgacaccgacgatctcgtctacacggtcgtcatc aacgacgaagaacagtattcgatctggccgacgttccggcccgtgccggccggctggcgc gaagtcggcgtacgcggcccgaaggccgactgcctcgcgcacatcgaagccgtctggacc gacatgcgccccgcgagcctgcgccgcgcgatggacggcgagcgcgcgtcgagcgcttcg tga

DBGET integrated database retrieval system