Phocaeicola dorei HS1_L_1_B_010: EL88_04620 Help Entry EL88_04620        CDS       T03262                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism bdo  Phocaeicola dorei HS1_L_1_B_010 Pathway bdo00020   Citrate cycle (TCA cycle) bdo01100   Metabolic pathways bdo01110   Biosynthesis of secondary metabolites bdo01120   Microbial metabolism in diverse environments bdo01200   Carbon metabolism bdo01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:bdo00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     EL88_04620 Enzymes [BR:bdo01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      EL88_04620 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_2 Fer4_6 Fer4_21 Fer4_7 Fer4_10 Fer4_9 Fer4_4 Fer4_16 Fer4_15 Fer4_8 Fer4_22 Fer4_20 Fer4_17 DUF5651 Fer4_13 Fer4_3 Motif Other DBs NCBI-ProteinID:  AII62485 LinkDB All DBs Position complement(1056981..1057211) Genome browser AA seq 76 aa AA seqDB search MAKIKGAIVVDTERCKGCNLCVVACPLHVIALNAKQVNKKGYTFAHQVLEDTCNGCASCA TVCPDGCITVYKVKQQ NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcaaagattaaaggtgctattgtagtagacacagagcgttgcaaaggttgcaatcta tgtgtagtggcatgtccgctacatgtaatcgcgctcaatgccaaacaagtgaataaaaaa ggatacacattcgcccaccaggtattagaggatacctgcaatggttgcgcatcatgtgcc acagtctgtccggacggatgcattactgtgtataaagtaaaacaacaataa

DBGET integrated database retrieval system