Bdellovibrio sp. qaytius: CIK05_03660 Help Entry CIK05_03660       CDS       T05880                                  Name (GenBank) hypothetical protein   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism bdq  Bdellovibrio sp. qaytius Pathway bdq00790   Folate biosynthesis bdq01100   Metabolic pathways bdq01240   Biosynthesis of cofactors Module bdq_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:bdq00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     CIK05_03660 Enzymes [BR:bdq01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      CIK05_03660  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      CIK05_03660  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      CIK05_03660 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AZZ35924 UniProt:  A0A3T0RP64 LinkDB All DBs Position 716621..716995 Genome browser AA seq 124 aa AA seqDB search MRQTLKINSYEVWMSLGVTKEEQAQLQPVHFDITLHFDKPVKGCATDHLDDAINYAALVS HIKKVATARPYNLIENICFLTHQHLTEWVKTHGFTGDLVTEATKVRPPVPSLQGGVKFSC QSPV NT seq 375 nt NT seq  +upstreamnt  +downstreamnt gtgcgacaaacattaaagatcaattcttatgaagtttggatgagtttgggtgtaactaaa gaagagcaagcccagcttcaacccgtacattttgatattactttgcatttcgataaacca gttaagggttgcgcgactgatcacttagatgatgcgatcaattacgcagccttagttagt catattaaaaaagtcgcgacagctcgcccttataatctgattgaaaacatttgtttttta actcaccagcatttaactgaatgggtaaagacgcatggctttactggtgatttggtgact gaggccacgaaagtgcgtccgccagtgccatcgctgcaaggtggagtcaaattttcatgt caaagtcctgtgtag

DBGET integrated database retrieval system