Burkholderia gladioli BSR3: bgla_1g16350 Help Entry bgla_1g16350      CDS       T01464                                  Name (GenBank) mbtH-like protein   KO K05375   MbtH protein Organism bgd  Burkholderia gladioli BSR3 Pathway bgd00261   Monobactam biosynthesis bgd01100   Metabolic pathways bgd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bgd00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     bgla_1g16350  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bgd01008]     bgla_1g16350 Polyketide biosynthesis proteins [BR:bgd01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     bgla_1g16350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AEA60285 UniProt:  F2LEA5 LinkDB All DBs Position 1:1817727..1817951 Genome browser AA seq 74 aa AA seqDB search MDDDLYFVVRNSEGQYSVWLDGRNLPAGWETVGEPASKQACLQRIEQLWTDMVPASVREH LNQHSGSEIDHAVR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggatgacgatttgtattttgtagtgcgaaacagcgaggggcagtactcggtatggctc gacggacgcaacctgcctgccggctgggagacggtcggtgaacccgccagcaagcaggcc tgcctgcagcggatcgagcaactttggacggacatggtgcccgccagcgtccgcgaacac ctcaaccaacattcgggatcggaaattgaccatgccgttcgatga

DBGET integrated database retrieval system