Burkholderia gladioli BSR3: bgla_2g16960 Help Entry bgla_2g16960      CDS       T01464                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism bgd  Burkholderia gladioli BSR3 Pathway bgd00261   Monobactam biosynthesis bgd01100   Metabolic pathways bgd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bgd00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     bgla_2g16960  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bgd01008]     bgla_2g16960 Polyketide biosynthesis proteins [BR:bgd01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     bgla_2g16960 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AEA64138 UniProt:  F2LPU9 LinkDB All DBs Position 2:complement(2168170..2168394) Genome browser AA seq 74 aa AA seqDB search MSWGDDDTTFHVVVNDEEQYSIWPEYKAIPAGWREAGKSGKKAECLAWIDEVWTDMRPAS LRRAMDDDAKRAAN NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgagctggggcgatgacgatacgacgtttcatgtggtcgtgaacgacgaggaacagtac tcgatctggccggaatacaaggcgattcccgccggctggcgcgaggccggcaagtcgggc aagaaggccgagtgcctggcctggatcgacgaggtctggaccgacatgcgcccggcgagc ctgcgtcgcgcgatggacgacgacgccaagcgcgcggcgaactga

DBGET integrated database retrieval system