Bacillus glycinifermentans: BGLY_0086 Help Entry BGLY_0086         CDS       T04537                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism bgy  Bacillus glycinifermentans Pathway bgy00790   Folate biosynthesis bgy01100   Metabolic pathways bgy01240   Biosynthesis of cofactors Module bgy_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:bgy00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     BGLY_0086 (folB) Enzymes [BR:bgy01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      BGLY_0086 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      BGLY_0086 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      BGLY_0086 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Phage_TAC_8 Motif Other DBs NCBI-ProteinID:  SCA83909 UniProt:  A0A1C3S837 LinkDB All DBs Position 1:94054..94437 Genome browser AA seq 127 aa AA seqDB search MIKEALIIDKVYVEGMEFYGYHGVFDEENKLGQRFRVDLTVYLDLNEAGKTDRIDATINY AELYKLCKEVVEGEPVNLVETLAETIAGRVLKQFQTVQECTVKVTKPDPPIPGHYKSVAI EMTRKRT NT seq 384 nt NT seq  +upstreamnt  +downstreamnt ttgataaaggaggcgcttatcatcgataaagtttatgttgaaggtatggagttttacggg tatcacggcgttttcgacgaggagaacaaactaggtcagcgatttcgcgtcgatttgacg gtctatcttgacctgaatgaagcggggaaaaccgatcgtattgatgcaaccattaattac gccgagctttataagctttgcaaagaggtcgtggaaggagagccggtcaacctcgtcgaa accctagcggaaacaatagcagggcgcgtgctcaaacaatttcagacggttcaggaatgc accgtaaaagtgacaaaacccgatccgccgatacccggccactataaatccgtagctatc gaaatgacgagaaagcggacatga

DBGET integrated database retrieval system