Bacteroides heparinolyticus: C3V43_04915 Help Entry C3V43_04915       CDS       T05405                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism bhf  Bacteroides heparinolyticus Pathway bhf00020   Citrate cycle (TCA cycle) bhf01100   Metabolic pathways bhf01110   Biosynthesis of secondary metabolites bhf01120   Microbial metabolism in diverse environments bhf01200   Carbon metabolism bhf01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:bhf00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     C3V43_04915 Enzymes [BR:bhf01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      C3V43_04915 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_21 Fer4_2 Fer4_7 Fer4_6 Fer4_10 Fer4_16 Fer4_9 Fer4_4 Fer4_15 Fer4_8 Fer4_22 Fer4_20 Fer4_17 Fer4_3 Fer4_13 DUF5651 Motif Other DBs NCBI-ProteinID:  AVM57162 UniProt:  A0A2R3MQG6 LinkDB All DBs Position 1192648..1192875 Genome browser AA seq 75 aa AA seqDB search MAKIKGAIVVDTERCKGCNLCVVACPLNVIALTKEVNAKGYNYAHQILEDTCNGCTSCAT VCPDGCISVYKVKVE NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcaaagattaaaggagcaatcgtagtggacaccgagcgttgcaaaggctgcaacctg tgcgtggtggcctgtccgctcaatgtaatagccctcaccaaagaggttaatgcaaaggga tacaactatgcccaccaaatattggaagatacatgcaacggctgcacatcgtgcgccacc gtatgtccggacggatgtatctccgtgtataaagtaaaagtagaataa

DBGET integrated database retrieval system