Bacillus halotolerans: DIC78_15215 Help Entry DIC78_15215       CDS       T06619                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism bht  Bacillus halotolerans Pathway bht00261   Monobactam biosynthesis bht01100   Metabolic pathways bht01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bht00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     DIC78_15215  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bht01008]     DIC78_15215 Polyketide biosynthesis proteins [BR:bht01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     DIC78_15215 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AZV50242 LinkDB All DBs Position 2982529..2982738 Genome browser AA seq 69 aa AA seqDB search MANPFENADGIYLVLINEEGQYSLWPGFIDVPSGWTVVHEQKGREACLDYIQSHWSDMRP NSLKPVENV NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggcaaatccttttgaaaatgcggatggcatataccttgttctcatcaatgaagagggc caatattccttgtggcccggctttatcgatgtgccgagcggctggacagtcgttcatgaa caaaaagggcgtgaggcttgtctggactacatccaatcacattggagcgatatgaggccg aacagcctaaagcctgtcgaaaatgtctaa

DBGET integrated database retrieval system