Bacteroides humanifaecis: JXR92_000025 Help Entry JXR92_000025      CDS       T08258                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism bhum  Bacteroides humanifaecis Pathway bhum00790   Folate biosynthesis bhum01100   Metabolic pathways bhum01240   Biosynthesis of cofactors Module bhum_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:bhum00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     JXR92_000025 (folB) Enzymes [BR:bhum01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      JXR92_000025 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      JXR92_000025 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      JXR92_000025 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  UDB44099 LinkDB All DBs Position 8272..8637 Genome browser AA seq 121 aa AA seqDB search MTSYIFLDTLRFFAHHGVGEQETVVGNEFTVSLRLQVDIRRAAETDDVADTVSYADVHTA VKAEMDIPSKLLEHVCGRIINRLFHDFPQIEEITLKLAKRNPPMGADIEAAGVEICQRRG E NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atgaccagttatattttccttgacacgcttcgcttcttcgcccatcacggcgtgggcgaa caagaaaccgtggtaggcaatgagtttaccgtcagcctgcgcctgcaagttgatatccgg cgtgcggcagaaacggacgacgtagccgacaccgtgagctatgccgatgtacatacagct gtgaaggcagagatggacattccttccaaactattggaacatgtatgcgggcgaattata aaccgattgttccacgacttcccgcagatagaagagataaccctcaagctggcaaagcgc aatccaccgatgggcgcggatatagaggctgcaggagtggagatatgccaacgccgcgga gaatga

DBGET integrated database retrieval system