Blautia hydrogenotrophica: BLHYD_28450 Help Entry BLHYD_28450       CDS       T09635                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism bhv  Blautia hydrogenotrophica Pathway bhv00020   Citrate cycle (TCA cycle) bhv01100   Metabolic pathways bhv01110   Biosynthesis of secondary metabolites bhv01120   Microbial metabolism in diverse environments bhv01200   Carbon metabolism bhv01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:bhv00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     BLHYD_28450 Enzymes [BR:bhv01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      BLHYD_28450 BRITE hierarchy Motif Pfam:  Fer4 Fer4_7 Fer4_21 Fer4_6 Fer4_10 Fer4_2 Fer4_9 Fer4_8 Fer4_4 Fer4_16 Fer4_17 Fer4_18 Fer4_3 Fer4_13 Fer4_22 Motif Other DBs NCBI-ProteinID:  WPX84826 LinkDB All DBs Position complement(2941339..2941542) Genome browser AA seq 67 aa AA seqDB search MAEVEINKDYCKSCKLCVNVCPKHVLFVGKYTNKMGYDAVEADETKGCIGCKMCATMCPE GAIEVYK NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atggcagaagtagagattaacaaagactactgcaaaagctgtaaactgtgcgtcaacgta tgtccaaagcatgttttgtttgtggggaaatatacaaacaaaatgggatatgacgcagta gaagcggatgagacgaaaggatgtattggctgcaagatgtgtgcgacaatgtgtccagaa ggtgcgatcgaagtatataagtga

DBGET integrated database retrieval system