Brachyspira hyodysenteriae WA1: BHWA1_01942 Help Entry BHWA1_01942       CDS       T00865                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism bhy  Brachyspira hyodysenteriae WA1 Pathway bhy00020   Citrate cycle (TCA cycle) bhy01100   Metabolic pathways bhy01110   Biosynthesis of secondary metabolites bhy01120   Microbial metabolism in diverse environments bhy01200   Carbon metabolism bhy01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:bhy00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     BHWA1_01942 Enzymes [BR:bhy01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      BHWA1_01942 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_2 Fer4_21 Fer4_6 Fer4_10 Fer4_15 Fer4_9 Fer4_16 Fer4_13 Fer4_22 Fer4_8 Fer4_17 Fer4_11 Fer4_3 Fer4_4 Fer4_18 Motif Other DBs NCBI-ProteinID:  ACN84403 UniProt:  A0A3B6VDS6 LinkDB All DBs Position 2240007..2240240 Genome browser AA seq 77 aa AA seqDB search MAKGRVTIDREQCKGCSNCISVCPTKILYLDKENMNSWGYYPAAVTDMEKCIGCANCAMM CPDICITVERLDKEEAK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggctaaaggtagagttactattgatagagaacaatgtaaaggatgttctaactgcata tctgtttgtccaactaagatactgtatttagataaagaaaatatgaattcttggggatat tatccagcagccgttactgatatggagaaatgtataggctgtgctaattgtgctatgatg tgtccggatatatgtataacagttgaaaggttagataaagaggaggctaaataa

DBGET integrated database retrieval system