Brachyspira intermedia: Bint_2759 Help Entry Bint_2759         CDS       T01847                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism bip  Brachyspira intermedia Pathway bip00020   Citrate cycle (TCA cycle) bip01100   Metabolic pathways bip01110   Biosynthesis of secondary metabolites bip01120   Microbial metabolism in diverse environments bip01200   Carbon metabolism bip01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:bip00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     Bint_2759 Enzymes [BR:bip01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      Bint_2759 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_21 Fer4_2 Fer4_6 Fer4_10 Fer4_15 Fer4_9 Fer4_16 Fer4_13 Fer4_22 Fer4_8 Fer4_17 Fer4_11 Fer4_3 Fer4_4 Fer4_18 Motif Other DBs NCBI-ProteinID:  AEM23353 UniProt:  G0EQQ7 LinkDB All DBs Position complement(3117373..3117606) Genome browser AA seq 77 aa AA seqDB search MAKGRVTIDREQCKGCSNCISVCPTKILYLDKENMNSWGYYPAAVTDMEKCIGCANCAMM CPDICITVERLDKEEGK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggctaaaggcagagttactattgatagagaacaatgtaaaggatgttctaattgcata tctgtttgtccaactaagatactgtatttagataaagaaaatatgaattcttggggatat tatccggcagctgttactgatatggaaaaatgtataggctgtgctaattgtgcgatgatg tgtccggatatatgtataacagtagaaaggttagacaaagaggagggtaaataa

DBGET integrated database retrieval system