Bacillus inaquosorum: AN935_16030 Help Entry AN935_16030       CDS       T07179                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism biq  Bacillus inaquosorum Pathway biq00261   Monobactam biosynthesis biq01100   Metabolic pathways biq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:biq00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     AN935_16030  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:biq01008]     AN935_16030 Polyketide biosynthesis proteins [BR:biq01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     AN935_16030 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AMA53703 LinkDB All DBs Position complement(3144249..3144458) Genome browser AA seq 69 aa AA seqDB search MANPFENADGTYLVLINEEGQYSLWPGFIDVPSGWTVVHEQKGREACLDYIQAHWSDMRP SSLKPVENV NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggcaaatccttttgaaaatgcggatggcacatatttggtgctgatcaatgaagagggc cagtattccctatggcccggttttatagatgtgccgagcggctggacagtcgttcatgag caaaaagggcgtgaagcttgtctggactatatccaagcgcattggagcgatatgaggcca agcagcttaaagcctgttgaaaatgtgtaa

DBGET integrated database retrieval system