Bacteroides intestinalis: DXK01_019405 Help Entry DXK01_019405      CDS       T06090                                  Name (GenBank) ferredoxin family protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism bis  Bacteroides intestinalis Pathway bis00020   Citrate cycle (TCA cycle) bis01100   Metabolic pathways bis01110   Biosynthesis of secondary metabolites bis01120   Microbial metabolism in diverse environments bis01200   Carbon metabolism bis01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:bis00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     DXK01_019405 Enzymes [BR:bis01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      DXK01_019405 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_2 Fer4_7 Fer4_21 Fer4_6 Fer4_10 Fer4_4 Fer4_9 Fer4_16 Fer4_15 Fer4_20 Fer4_22 Fer4_8 Fer4_3 Fer4_17 Fer4_13 DUF5651 Fer4_18 Motif Other DBs NCBI-ProteinID:  QDO70929 LinkDB All DBs Position 5023642..5023869 Genome browser AA seq 75 aa AA seqDB search MAKIKGAIVVDTERCKGCNLCVVACPLHVIALTKEVNVKGYNYAHQILEDTCNGCASCAQ VCPDGCISVYKVKVE NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcaaagattaaaggagcaatcgtagtggacaccgaacggtgcaaaggctgcaatcta tgcgtggtagcctgtcctctgcatgtaatagccctcaccaaagaggtgaacgtaaaaggg tataactatgcccaccaaatactggaagatacctgcaacggctgtgcgtcgtgcgcccag gtttgcccggacggatgtatctctgtttataaagtaaaagttgaataa

DBGET integrated database retrieval system