Bacillus spizizenii: BIS30_05505 Help Entry BIS30_05505       CDS       T05513                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism bit  Bacillus spizizenii Pathway bit00261   Monobactam biosynthesis bit01100   Metabolic pathways bit01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bit00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BIS30_05505  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bit01008]     BIS30_05505 Polyketide biosynthesis proteins [BR:bit01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BIS30_05505 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AJW84657 LinkDB All DBs Position complement(1009117..1009326) Genome browser AA seq 69 aa AA seqDB search MANPFENADGTYLVLINEEGQYSLWPGFIDVPSGWTVVHEQKGREACLVYIQSHWSDMRP NSLKPVENV NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggcaaatccttttgaaaatgcggatggcacatatttggtgctgattaatgaagagggc caatattccctatggcccggttttatagatgtgccgagcggctggacagtcgttcatgag caaaaagggcgtgaagcttgtctggtctatatccaatcgcattggagcgatatgaggccc aacagcctaaagcctgttgaaaatgtgtaa

DBGET integrated database retrieval system