Blastochloris tepida: BLTE_14970 Help Entry BLTE_14970        CDS       T05837                                  Name (GenBank) 4Fe-4S ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism blag  Blastochloris tepida Pathway blag00020   Citrate cycle (TCA cycle) blag01100   Metabolic pathways blag01110   Biosynthesis of secondary metabolites blag01120   Microbial metabolism in diverse environments blag01200   Carbon metabolism blag01210   2-Oxocarboxylic acid metabolism Module blag_M00009   Citrate cycle (TCA cycle, Krebs cycle) blag_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:blag00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     BLTE_14970 Enzymes [BR:blag01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      BLTE_14970 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_2 Fer4_6 Fer4_21 Fer4_10 Fer4_4 Fer4_16 Fer4_9 Fer4_8 Fer4_17 Fer4_3 Fer4_22 Fer4_18 ETF_QO Motif Other DBs NCBI-ProteinID:  BBF92812 UniProt:  A0A348FZS9 LinkDB All DBs Position complement(1605232..1605471) Genome browser AA seq 79 aa AA seqDB search MSFGKLKKAYGKVTINPNWCKGCGFCVEYCPTDALEMSTAYNAKGYHPPRVKNADECRDC KFCEKVCPEFAIFVTTDQR NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtcgttcggcaagctcaagaaggcctatggcaaagtgaccatcaacccgaactggtgc aagggctgcggtttctgcgtcgaatactgtccgaccgacgccttggagatgtctacggcc tataacgccaagggctatcatccgccccgggtgaagaatgccgatgagtgccgggactgc aagttctgcgaaaaggtttgccctgagttcgcgattttcgtgacgaccgatcaaagatga

DBGET integrated database retrieval system