Blautia parvula: LC508_25340 Help Entry LC508_25340       CDS       T09421                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism blar  Blautia parvula Pathway blar00020   Citrate cycle (TCA cycle) blar01100   Metabolic pathways blar01110   Biosynthesis of secondary metabolites blar01120   Microbial metabolism in diverse environments blar01200   Carbon metabolism blar01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:blar00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     LC508_25340 Enzymes [BR:blar01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      LC508_25340 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_6 Fer4_7 Fer4_10 Fer4_21 Fer4_2 Fer4_9 Fer4_4 Fer4_15 Fer4_16 Fer4_8 Fer4_3 Fer4_13 Fer4_22 Fer4_17 Fer4_18 Motif Other DBs NCBI-ProteinID:  UBU21247 LinkDB All DBs Position 5564695..5564898 Genome browser AA seq 67 aa AA seqDB search MAKAKATADTSLCKGCRLCVGVCPVKAIEPLTEINKKGYEIIRIDEETCIGCGQCYKICP DYVFTIE NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atggcaaaagcaaaagcaactgcggacaccagcttatgcaagggctgccgcctgtgtgta ggggtatgtccggtgaaagccattgagcctctcactgagatcaacaaaaaaggatacgag atcatcagaatcgatgaagaaacctgtatcggatgcggacagtgctataagatctgtccc gattatgtatttaccattgagtag

DBGET integrated database retrieval system