Bacillus licheniformis ATCC 14580: BL04025 Help Entry BL04025           CDS       T00197                                  Name (GenBank) conserved hypothetical protein   KO K05375   MbtH protein Organism bli  Bacillus licheniformis ATCC 14580 Pathway bli00261   Monobactam biosynthesis bli01100   Metabolic pathways bli01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bli00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BL04025  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bli01008]     BL04025 Polyketide biosynthesis proteins [BR:bli01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BL04025 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AAU25337 UniProt:  Q65E03 LinkDB All DBs Position complement(3718051..3718275) Genome browser AA seq 74 aa AA seqDB search MTNPFENEHGTYVVLMNQDGQYSLWPAFIHIPAGWEVVCGEASRSACIDYISSNWTDLSP NSIKLVAEVHGGQQ NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacaaatccttttgaaaatgaacacggcacatatgtcgttttaatgaatcaggatggc cagtattcactctggccggccttcattcatattccggcagggtgggaggtcgtctgcggg gaagcgagccgcagcgcctgtatcgactatatcagctcgaattggaccgatctctcgccg aacagcatcaagctggttgcagaagtacacggcggtcagcaatga

DBGET integrated database retrieval system