Blautia liquoris: INP51_10080 Help Entry INP51_10080       CDS       T07726                                  Name (GenBank) ferredoxin family protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism bliq  Blautia liquoris Pathway bliq00020   Citrate cycle (TCA cycle) bliq01100   Metabolic pathways bliq01110   Biosynthesis of secondary metabolites bliq01120   Microbial metabolism in diverse environments bliq01200   Carbon metabolism bliq01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:bliq00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     INP51_10080 Enzymes [BR:bliq01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      INP51_10080 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_9 Fer4_10 Fer4_2 Fer4_16 Fer4_21 Fer4_6 Fer4_13 Fer4_4 Fer4_22 Fer4_17 Fer4_3 Fer4_18 Fer4_8 ETF_QO Se_S_carrier Fer4_15 Motif Other DBs NCBI-ProteinID:  QOV18364 UniProt:  A0A7M2REH4 LinkDB All DBs Position complement(2194369..2194599) Genome browser AA seq 76 aa AA seqDB search MPEVKVVSERCKSCGYCVKFCPKNVLEIGTKVNSKGYEYVTPKNIQNCIGCCICGRMCPE GALEIYKEEQGAKKNV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgcctgaagtaaaagtagtatcagaacgctgtaaaagctgcggctattgcgtgaaattc tgtcctaaaaatgttctggagatcggaacaaaagtgaattctaaggggtatgaatatgta actccaaagaatatacagaactgtatcggatgctgcatctgcggaagaatgtgtccggaa ggtgcattagaaatttataaagaagaacagggggccaaaaagaatgtctag

DBGET integrated database retrieval system