Burkholderia mallei ATCC 23344: BMA3382 Help Entry BMA3382           CDS       T00204                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism bma  Burkholderia mallei ATCC 23344 Pathway bma00790   Folate biosynthesis bma01100   Metabolic pathways bma01240   Biosynthesis of cofactors Module bma_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:bma00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     BMA3382 (folB) Enzymes [BR:bma01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      BMA3382 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      BMA3382 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      BMA3382 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB DUF5318 Motif Other DBs NCBI-ProteinID:  AAU48621 UniProt:  A0A0H2WHE6 LinkDB All DBs Position 1:complement(3491554..3491958) Genome browser AA seq 134 aa AA seqDB search MFAALLHPRLADCRRLYLRNHEVYMNIGAFEHEKRGEQRVVINVDLFVPLALTTPVEDRL REVVDYDLMKQSVAQCVARGHIHLQETLCDAIAASLLAHDAVRAVRVSTEKPDAYPDCDA VGVEVFRIKDEERA NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgtttgccgccctcctgcatcccaggctcgccgattgccgcaggctctacctgcgcaac cacgaggtgtacatgaacatcggcgccttcgagcacgagaagcgcggcgagcagcgcgtc gtcatcaatgtcgatctgttcgtgccgctcgcgctgacgacgcccgtcgaggacaggctg cgcgaagtcgtcgactatgatctgatgaagcaaagcgtcgcgcagtgcgtcgcgcgcggc cacatccatctgcaggaaacgctctgcgacgcgatcgcggcgagcctgctcgcgcacgac gcggtgcgcgcggtgcgcgtgtccaccgagaagccggacgcctaccccgattgcgacgcc gtcggcgtcgaagtatttcgcatcaaggacgaggagcgagcatga

DBGET integrated database retrieval system