Burkholderia mallei 6: DM78_1497 Help Entry DM78_1497         CDS       T03489                                  Name (GenBank) mbtH-like family protein   KO K05375   MbtH protein Organism bmae  Burkholderia mallei 6 Pathway bmae00261   Monobactam biosynthesis bmae01100   Metabolic pathways bmae01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bmae00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     DM78_1497  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bmae01008]     DM78_1497 Polyketide biosynthesis proteins [BR:bmae01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     DM78_1497 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AIO58235 LinkDB All DBs Position 1:1636626..1636850 Genome browser AA seq 74 aa AA seqDB search MDDELYFVVRNNEGQYSVWMDGRSLPAGWETVGEPATKQQCLQRIEQLWTDMVPASVREH LNQHSGPGIDYAVR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggacgacgaattgtacttcgtagtgcgaaataatgagggccagtattcggtctggatg gacgggcgaagccttcccgccggttgggaaacggtcggcgaacctgcgacgaagcaacag tgtctgcaacgcatcgagcaactctggacggacatggtgcctgccagcgtccgcgagcat ctcaatcaacattcgggcccgggaatcgactatgccgtacgatga

DBGET integrated database retrieval system